SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017253 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017253
Domain Number 1 Region: 509-633,672-844
Classification Level Classification E-value
Superfamily TPR-like 8.78e-31
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 120-154,370-460
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000879
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017253
Domain Number - Region: 68-147
Classification Level Classification E-value
Superfamily HCP-like 0.0183
Family HCP-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017253   Gene: ENSPANG00000022915   Transcript: ENSPANT00000014417
Sequence length 858
Comment pep:known_by_projection chromosome:PapAnu2.0:13:45936675:46070065:1 gene:ENSPANG00000022915 transcript:ENSPANT00000014417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKGAHGSHLKVESELERCRAEGHWDRMPELVRQLQSLSMPGGGGNRRGIPSAAFTFPD
TDDFGKLLLAEALLEQCLKENHAKIKDSIPLLEKNEPKMSEAKNYLSSILNHGRLTPQYM
CEAMLILGKLHYVEGSYRDAISMYARAGIDDVSMENKPLYQMRLLSEAFVIKGLSLERLP
NSIASRFRLTEREEEVIACFERASWIAQVFLQELEKTTNNSTSRHLKGCHPVDYELTYFL
EAALQSAYVKNLKKGNIVKGMRELREVLRTVETKATQNFKVMAAKHLAGVLLHSLSEECY
WSPLSHPLPEFMGKEENSFATQALRKPHLYEGDNLYCPKDNIEEALLLLLISESMATRDV
VLSRVPEQEEDRAVSLQNAAAIYDLLSITLGRRGQYVMLSECLERAMKFAFGEFHLWYQV
ALSMVACGKSAYAVSLLRECVKLRPSDPTVPLMAAKVCIGSLHWLEEAERFAMMVISLGE
EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPGDPQVILYVSL
QLALVRQISSAMEQLQEALKVCKDDAHALHLLALLFSAQKHHQHALDVVNMAITEHPENF
NLMFTKVKLEQALKGPEEALVTCRQMLRLWQTLYSFSQLGGLEKDGSLGEGLTMKKQSGM
HLTLPDAHDADSGSRRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAEL
FMEQKHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGSLEEAKQLYKEALTVNPDGVR
IMHSLGLMLSRLGHKSLAQKVLRDAVERQSTCHEAWQGLGEVLQAQGQNEAAVDCFLTAL
ELEASSPVLPFSIIPREL
Download sequence
Identical sequences A0A096NW28
ENSPANP00000017253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]