SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017259 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017259
Domain Number 1 Region: 8-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000035
Family LIM domain 0.0099
Further Details:      
 
Domain Number 2 Region: 189-255
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000077
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 68-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000175
Family LIM domain 0.0071
Further Details:      
 
Domain Number 4 Region: 130-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000017
Family LIM domain 0.0078
Further Details:      
 
Domain Number 5 Region: 251-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000345
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017259   Gene: ENSPANG00000000712   Transcript: ENSPANT00000007779
Sequence length 284
Comment pep:known_by_projection chromosome:PapAnu2.0:4:91921068:91973427:1 gene:ENSPANG00000000712 transcript:ENSPANT00000007779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAQFYCQYCTASLLGKKYVLKDDSTYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDR
HWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKG
NYWHETCFVCENCRQPIGTKPLISKESGNFCVPCFEKEFAHYCNFCKKVITSGGITFCDQ
LWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICF
QDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDSDI
Download sequence
Identical sequences A0A096NW34
ENSPANP00000017259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]