SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017281 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017281
Domain Number 1 Region: 868-1167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.41e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000135
Further Details:      
 
Domain Number 2 Region: 216-360
Classification Level Classification E-value
Superfamily PH domain-like 4e-33
Family Third domain of FERM 0.0018
Further Details:      
 
Domain Number 3 Region: 109-214
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-26
Family Second domain of FERM 0.00046
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-18
Family First domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017281   Gene: ENSPANG00000009613   Transcript: ENSPANT00000006654
Sequence length 1171
Comment pep:known_by_projection chromosome:PapAnu2.0:7:144567925:144653961:-1 gene:ENSPANG00000009613 transcript:ENSPANT00000006654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFYVPSVSQLQQEITSRYQ
YYLQLKKDILEGSIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEK
VLEEATQKVALLHQKYRGLAAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLE
GIFVKHKNGRHPVVFSWHDMPNMSHNKSFFALELANKEETIQFQTEDMETAKYIWRLCVA
RHKFYRLNQCNLQTQTVTVNPIRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYASSQ
DNLFVPNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNP
SITGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGLVHAERQSHSLRNLNIGS
SYAYSRPAALVYSQPEIREHAQLPSPPTAHCPFSLSYSFHSPSPYPYPAERRPVVGAVSV
PELTNAQLQAQDYPAPNIMRTQVYRPPPPYPPPRPANSTPDLSRHLYISSSNPDLITRRV
HHSVQTFQEDSLPVAHSLQEVSEPLTAARHAQLHKRNSIEVAGLSHCLEGLRLKERTLST
SAAEVVPRALSAGSQPSVFTERTKREGQEEAEGLRYGHEKSLSDATMLIHSSEEEEDEDF
EEESRARASPGRAREPRPGLTQDPPGCPRALLAGPLHILEPKGHVPDSEKRMMDSSPVRT
TAEAQRPWRDGLLTPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGLPPLGGM
KKTRVDGPLKLAALNGLSLSRVPLPDEGKEVATRATNDERCKILEQRLEQGMVFTEYERI
LKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSVSGI
EWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTY
GRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSYLEE
IQSVRRHTNSTSDPQSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRVLDML
RQQRMMLVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences ENSPANP00000017281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]