SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017310 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017310
Domain Number 1 Region: 519-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-71
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 91-179
Classification Level Classification E-value
Superfamily TPR-like 0.0000341
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017310   Gene: ENSPANG00000000257   Transcript: ENSPANT00000008504
Sequence length 860
Comment pep:known_by_projection chromosome:PapAnu2.0:4:75555793:75596664:1 gene:ENSPANG00000000257 transcript:ENSPANT00000008504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
SPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKTLSASMVLTAQESFSSSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLKQTNKTKQSCPFGRVPLNLLNSPDCDVKTDDSVVPCFIKRG
KRQTSRSECRDLVVAGSKPSGNDSCELRNLKSVQNIHCKEPLVSDEKSSELIITDSVTLK
NKTESSLRAKLEETKEYQEPEVPESNQKQWQSKRKSACINQNPVASSNQWQIPELARKVN
IEQKHTTFEQPVFSVSKQSPPMSASKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPP
ACQLSTPYGQPACFQQQQQQIPATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSS
KVFQVLNEKKQIYAIKFVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQY
IYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVD
GMLKLIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDV
WSLGCILYYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPK
QRISIPELLAHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYS
GGESHNSSSSKTFVKSRLGK
Download sequence
Identical sequences ENSPANP00000017310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]