SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017337 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017337
Domain Number 1 Region: 544-695
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.17e-57
Family Ankyrin repeat 0.0000227
Further Details:      
 
Domain Number 2 Region: 32-265,300-325
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-53
Family BAR domain 0.031
Further Details:      
 
Domain Number 3 Region: 428-543
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.24e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000103
Further Details:      
 
Domain Number 4 Region: 279-397
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000755
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017337   Gene: ENSPANG00000026395   Transcript: ENSPANT00000009714
Sequence length 904
Comment pep:known_by_projection chromosome:PapAnu2.0:1:25645386:25699569:-1 gene:ENSPANG00000026395 transcript:ENSPANT00000009714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRCRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYETKMAKLEKERDRARVTGGIPGEVAQ
DTQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEEELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTLSTFRSLEPLVQALCERWVSVLQNSKDEALSSAFLGEPSGGLGSWGAAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSPESDMGTRRDYIVAKYVEHRF
ARRCTPEPRRLWTAICNRDLLLVLEAFANGQDFGQPLPGPEAQAPEELALHLAIKVASQA
SLPLVDFIIQNGGHLDAKATDGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
VARKKHHKECEELAAGAGSGGTLAFPLHVDYSWVISTEPGFDSEEDEEEKRCLLKLPVQA
HWASGRLDISNKTYETVTSLGAATPQGESEDCPPPLPVKNSSRTVVQGCARRASGDHSEV
SSLSSEAPETPENLGSPASSSSLMSPVEPGGPSQAPPNSEEGLREPPGTSRPSLTSGTTP
LEMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNMPVGVTEGDGSRTGSLPASSVQ
LLQD
Download sequence
Identical sequences ENSPANP00000017337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]