SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017340 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017340
Domain Number 1 Region: 813-878
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.36e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017340   Gene: ENSPANG00000001128   Transcript: ENSPANT00000022186
Sequence length 888
Comment pep:known_by_projection chromosome:PapAnu2.0:1:1617105:1762931:1 gene:ENSPANG00000001128 transcript:ENSPANT00000022186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCTLLVSQFRSCQ
DNVLNIINQIMDECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELE
SMAMRPLAKELTRSLEDVRGALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMV
PVKSPREYYVQQEVIVLFCETVERALDFGYLTQDMIDDYEPALMFSIPRLAIVCGLVVYA
DGPLNLDRKAEDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLCISQDVEFPIRADV
QGPAVLTPALSAPLPPEGPLSVKAKDPDAELACSMQYDDQELEQLSRMVHRAGDEMSSLL
SPPSACQSPAHRPGAEGSPGEEASPRKARLRSGSDEEERVFFMDDVEGTAEALARPESPG
GPFGWAGSIRADPQEKGQGGPGGAAGVSVPASEKEEDLSNNNNPEAEGTGRASLAGTSSC
SCLDSRLHLDGWEVGADDAETAEMIAHRTGGMKLSATVIFNPKSPTSLDSAVATQEAASE
PVAEGMDGGPHKLSTAATNCLLHSCVCCGSCGDSREDVVERLQEKCSPGGVIGASYAASL
AKASDRAAERQDEAPPPSEDASDGREPKAPTSNKCLPHTSGSQVDTASGLQGEAGVAGQQ
EPEVRELDAGSPSAHEAPQPLSGSSSSAAGSCSSDQMGPEVAPAATHVAPQATREKIRSR
FHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKLRKVTQTL
RSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCMACKAPFTVIRRKHHC
RSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL
Download sequence
Identical sequences A0A096NWB3
ENSPANP00000017340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]