SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017354 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017354
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-49
Family Hypothetical protein AT3g04780/F7O18 27 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017354   Gene: ENSPANG00000005407   Transcript: ENSPANT00000022141
Sequence length 211
Comment pep:known_by_projection chromosome:PapAnu2.0:1:25994661:26004029:1 gene:ENSPANG00000005407 transcript:ENSPANT00000022141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEE
RTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTE
REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELR
RHEVTICNYEASANPADHRVHQVTPQTHFIS
Download sequence
Identical sequences A0A096NWC7 A0A0D9S888 A0A250YCG1 A0A2J8SJ27 A0A2K5CKD5 A0A2K5LR43 A0A2K6E3F2 A0A2K6QU74 A0A2K6TRR3 F7CKL5 G1RBE3 G3QNW5 I3NCL1 I7G9N5 Q9GZP4
ENSMMUP00000025686 ENSP00000246151 9544.ENSMMUP00000025686 9606.ENSP00000246151 NP_001247723.1.72884 NP_001270122.1.63531 NP_065095.2.87134 NP_065095.2.92137 XP_002716029.3.1745 XP_003271649.1.23891 XP_003934920.1.74449 XP_004024942.1.27298 XP_005317650.1.77405 XP_007978262.1.81039 XP_008571201.1.73410 XP_010354066.1.97406 XP_011761128.1.29376 XP_011800960.1.43180 XP_011935574.1.92194 XP_012295221.1.9421 XP_017741962.1.44346 XP_020010901.1.5219 ENSP00000246151 ENSPANP00000017354 ENSGGOP00000004243 GO.35311 HR2112 gi|21361837|ref|NP_065095.2| ENSNLEP00000010540 ENSMMUP00000025686 ENSNLEP00000010540 ENSGGOP00000004243 ENSP00000246151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]