SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017358 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017358
Domain Number 1 Region: 67-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.15e-46
Family Regulator of G-protein signaling, RGS 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017358   Gene: ENSPANG00000017181   Transcript: ENSPANT00000006036
Sequence length 206
Comment pep:known_by_projection chromosome:PapAnu2.0:8:50013152:50029548:1 gene:ENSPANG00000017181 transcript:ENSPANT00000006036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAQDAPGAAPGQPGAGSRGSNACCFCWCCCCSCSWNEERERRCLPKIKWYISKESDLTSK
RVNTVNPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEA
NKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHR
DSYPRFMNSAVYKDLLQSLSEKSIEA
Download sequence
Identical sequences ENSPANP00000017358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]