SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017380 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017380
Domain Number 1 Region: 477-653
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 631-735
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-17
Family Ypt/Rab-GAP domain of gyp1p 0.029
Further Details:      
 
Domain Number 3 Region: 799-924
Classification Level Classification E-value
Superfamily EF-hand 0.00000152
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017380   Gene: ENSPANG00000022369   Transcript: ENSPANT00000016702
Sequence length 1140
Comment pep:known_by_projection chromosome:PapAnu2.0:13:92379583:92513075:-1 gene:ENSPANG00000022369 transcript:ENSPANT00000016702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKPEEVLLKNALKLWVTQKSSCYFILQRRRGHGEGGGRLTGRLVGALDAVLDSNARVA
PFRILLQVPGSQVYSPIACGATLEEINQHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKA
LIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYL
SINHLCFYSFFLGKELKLVVPWVDIQKLERTSNVFLTDTIRITTQNKERDFSMFLNLDEV
FKVMEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLH
AVVDCSLWTPFSRCHTAGRMFTSDSYICFASREDGCCKIVLPLREVVSIEKMEDTSLLPH
PIIVSIRSKVAFQFIELRDRDSLVEALLVRLKQVHANHPVHYDTSVDDDMASPVFHSTSM
CGDHRFGDLEMVSSQSSEESEKEKSPLLHPDALVTAFQQSGSQSPDSQMSREQIKISLWN
DHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEESL
GKCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVL
LLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKGHLPELAEHMNDLSAL
ASVSLSWFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEDLCSSKDDGQA
LMILSRFLDHIKNEDSPGPPVGSHHAFFSDDQEPYPVTDISDLIRDSYEKFGDQSVEQIE
HLRYKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKREHMMSCYWEQPRPT
ASRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGAHTEILAERTFRLLDDNMDQLIEFKA
FVSCLDTMYNGEMNEKIKLLYRLHIPPALTENDRDSQSPLKNPLLSTSRPLVFGKPNGDA
VDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATV
TTLLLQIGEVGQRSSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEEAQAD
WTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTSEMSHQSQSELKLSNL
Download sequence
Identical sequences A0A096NWF3
ENSPANP00000017380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]