SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017431 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017431
Domain Number 1 Region: 3-218
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.56e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017431   Gene: ENSPANG00000026474   Transcript: ENSPANT00000029257
Sequence length 276
Comment pep:novel scaffold:PapAnu2.0:JH685341.1:2700:38179:-1 gene:ENSPANG00000026474 transcript:ENSPANT00000029257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFNLLKHIQFKTKVCSVTKCSDFT
VSGQWEVVTMRDEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMVRKINNWLNHANYGLIPEER
Download sequence
Identical sequences ENSPANP00000017431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]