SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017457 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017457
Domain Number 1 Region: 310-393
Classification Level Classification E-value
Superfamily CAD & PB1 domains 8.83e-17
Family PB1 domain 0.0055
Further Details:      
 
Domain Number 2 Region: 399-460
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-16
Family SH3-domain 0.00051
Further Details:      
 
Domain Number 3 Region: 14-153
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000297
Family Tetratricopeptide repeat (TPR) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017457   Gene: ENSPANG00000026337   Transcript: ENSPANT00000028909
Sequence length 476
Comment pep:known_by_projection chromosome:PapAnu2.0:15:771829:785274:-1 gene:ENSPANG00000026337 transcript:ENSPANT00000028909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGDLVRAWDLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDAEAALRA
FDQAVTKDTCMAVGFFQRGVANFQLARFQEALSDFRLALAQLRGHAAIDYTQLGLRFKLQ
AWEVLYNVASAQCQLGLWTEAAGSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPR
GEVFRPHRRHLEHLEPVDFLGKAKVVASAIPDDQRWGVRPQQPQGLGANLDARSPVMDSP
RAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLPPGPPATGAPGPGPCEDPA
GAGGAGAGGSEPLVTVTVQCTFTVALRARRGADLSSLRALLGQALPHQAQLGQLSYQAPG
EDRQWVPIPEEESLQRAWLDAAAGPRGLQLQCRGAGGRPVLYQVVAQYSYSAQGPEDLGF
RQGDMVDVLCEVDEAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGCLPRSQQGDHP
Download sequence
Identical sequences ENSPANP00000017457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]