SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017500 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017500
Domain Number 1 Region: 37-524
Classification Level Classification E-value
Superfamily TPR-like 2.53e-131
Family Tetratricopeptide repeat (TPR) 0.0000000000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017500   Gene: ENSPANG00000004520   Transcript: ENSPANT00000004366
Sequence length 1170
Comment pep:known_by_projection chromosome:PapAnu2.0:1:180717764:180773808:-1 gene:ENSPANG00000004520 transcript:ENSPANT00000004366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNWMFLQIVIVGENVSFKSQMRTENLKSEEHLKSSNIRQAEVLKADMTDSKLGPAEVWT
SRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANL
SLFLEAASGFYTQLLQELCTVFNVDLPCRVKSSQLGIISNKQTHTSAIVKPQSSSCSYIC
QHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCR
SIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSP
LREKLEEQFKRLLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHSYSQDEQLCWTQL
LALFMSFLGILCKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWP
WLISLLNSFHPHEEDLSSTSATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQQ
RRLRQQRLIAIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEAKENLILQETSV
IESLAADGSPGLKSVLSTSRNLSNNCDTGEKPVVTFKENIKPREVNRDQGRSFPPKEVKS
QTELRKTPVSEARKTPVTQTPTQASNSQFIPIHHPGAFPPLPSRPGFPPPTYVIPPPVAF
SMGSGYTFPAGVSVPGTFLQPTAHSPAGNQVQAGKQSHIPYSQQRPSGPGPMNQGPQQSQ
PPSQQPLTSLPAQPTAQSTSQLQVQALTQQQQSPTKAVPALGKSPPHHSGFQQYQQADAS
KQLWNPPQVQGPLGKIMPVKQPYYLQTQDPIKLFEPSLQPPVMQQQPLEKKMKPFPMEPY
NHNPSEVKVPEFYWDSSYSMADNRSVMAQQANIDRRGKRSPGVFRPEQDPVPRMPFEDPK
SSPLLPPDLLKSLAALEEEEELIFSNPPDLYPALLGPLASLPGRSLFKSLLEKPSELMSH
SSSFLSLTGFSLNQERYPNNSMFNEVYGKNLTSSSKAELNPSMAPQETSLYSLFEGTPWS
PSLPASSDHSTPASQSPHSSNPSSLPSSPPTHNHNSVPFSNFGPIGTPDNRDRRTADRWK
TDKPAMGGFGIDYLSATSSSESSWHQASTPSGTWTGHGPSMEDSSAVLMESLKSIWSSSM
MHPGPSALEQLLMQQKQKQQRGQGTMNPPH
Download sequence
Identical sequences A0A2I3M954 A0A2K5KPI3 A0A2K5ZEK7 F7C572
XP_011744624.1.29376 XP_011903449.1.92194 XP_014977615.1.72884 XP_014977630.1.72884 ENSPANP00000017500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]