SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017502 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017502
Domain Number 1 Region: 76-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.93e-47
Family Regulator of G-protein signaling, RGS 0.000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017502   Gene: ENSPANG00000012828   Transcript: ENSPANT00000019652
Sequence length 235
Comment pep:known_by_projection chromosome:PapAnu2.0:1:172106906:172136725:-1 gene:ENSPANG00000012828 transcript:ENSPANT00000019652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHED
TCSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACE
DFKKSKGPQQIHLKAKAIYEKFIKTDAPKEVNLDFHTKEVITKSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYLDLIEGRPQRPTNLRRRSRSFTCNEFQDVQSDAAIWL
Download sequence
Identical sequences A0A096NWS0
ENSPANP00000017502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]