SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017506 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017506
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017506   Gene: ENSPANG00000003888   Transcript: ENSPANT00000024051
Sequence length 533
Comment pep:known_by_projection chromosome:PapAnu2.0:1:122017115:122048311:-1 gene:ENSPANG00000003888 transcript:ENSPANT00000024051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
STSGQWEVVTESEGKKEMNVFDGVMVCTGHHTDAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVGNYGYPFDVLFSSRL
THFMWKICGQSLANKYLETKINQRFDHEMFGLKPKHRALSQHPTVNDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFAFPFLEDSVKVVKNKISLYKRVFPPN
LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKTQEKIEKRY
VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRLQGPGK
WDGARKAILTTEDRIRKPLMTRVVERSSSMTSTMTMGRFMLALAFFAIIIAYF
Download sequence
Identical sequences A0A096NWS4
ENSPANP00000017506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]