SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017510 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017510
Domain Number 1 Region: 670-697
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000157
Family CCCH zinc finger 0.0033
Further Details:      
 
Domain Number 2 Region: 777-799
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000667
Family CCCH zinc finger 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017510
Domain Number - Region: 743-776
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number - Region: 725-747
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00994
Family CCCH zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017510   Gene: ENSPANG00000016578   Transcript: ENSPANT00000009335
Sequence length 929
Comment pep:known_by_projection chromosome:PapAnu2.0:8:138290564:138396602:-1 gene:ENSPANG00000016578 transcript:ENSPANT00000009335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKEILRRQIRLLQGLIDDYKTLHGNAPGPGTPTASGWQPPTYHSGRAFSARYPRPSRR
GYSSHHGPLWRKKYSLVNRPPGPSDPPADPAVRPLHGARGGPAPVPQQHILGRQVQLNQG
QNVVIKVKPPSKSGSASASGAQRGSLEEYEDTLWSDQRPREGEGEPPRGQLQPSRPARMR
GTCNVEDPLLVCQKEAGKPRVVKSVGSVGDSPREPRRTVSESVIAIKASFPSSALPPRTG
VVPGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVVGPARLASGPRQAREASLVVT
CRTNKFRKNNYKWVAASAKSPRAARRALSPRVAAENVCKVPAGTANKVEKPQLIDDPEPK
PRKPATSSKPGSAPSKYKWKASSPSASSSSSFRWQSEAGSKDHASQLSPVPSRSPPGDRP
AVGLSGLKPVSGETPLSAYKVKSRTKIIRRRGSTSLPGDKKGSPAPATTAKSHLSLRRRQ
ALRGKSSPILKKTPNKGLVQVTTHRLCRLPPSRAHLTTKEASSLRAVQTPPTSKVIKTRY
RIVKKTPASPLSAPPFPLSLPSWRARRLSLSRSLVLNRLRPVASGGGKAQPGSPRWRSKG
YRCIGGVLYKVSANKLSKTSGQPGDAGSKPLLRTAGRLDPAGSCSRSLASRAVQRSLAII
RQARQRREKRKEYCMYYNRFGRCNRGERCPYIHDPEKVAVCTRFVRGTCKKTDGTCPFSH
HVSKEKMPVCSYFLKGICSNSNCPYSHVYVSRKAEVCSDFLKGYCPLGAKCKKKHTLLCP
DFARRGACPRGAQCQLLHRTQKRHSRRAATSPAPGPSDAAARSRASASHGPRKPSAAQRP
IRQTPSSPALTAAALAAPSRSPGGSALDHEAPSLQEAALAAARSNRLCKLPSFISLQSSP
SPGAQPRVRAPRAPLTKDSGKPLHIKPRL
Download sequence
Identical sequences ENSPANP00000017510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]