SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017527 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017527
Domain Number 1 Region: 155-216,262-357,385-537
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.84e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000144
Further Details:      
 
Domain Number 2 Region: 515-643
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.25e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000846
Further Details:      
 
Domain Number 3 Region: 58-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-25
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017527   Gene: ENSPANG00000000735   Transcript: ENSPANT00000019920
Sequence length 645
Comment pep:novel chromosome:PapAnu2.0:2:45840565:45890560:-1 gene:ENSPANG00000000735 transcript:ENSPANT00000019920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEQSPPQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSSSSEAREELRRRLR
GLIERSRVMIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGAKVQEVLSEITNQKTV
PNVFVNKVHVGGCDQTFQAYQSGLLQKLLQEDSAYDYDLIIVGGGSGGLSCAKEAAILGK
KVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQERL
IVEFECKRLNNHYFQISFKYKLSKRERNIGYWFVFGDLIQTKKIKVTNKKGQETYYTAAQ
FVIATGERPRYLGIQGDKEYCITSKLNYVDMFPLPYCPGKTLVVGASYVALECAGFLAGF
GLDVTVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMIQQLEKGSPGKLKVLAK
STEGTETIEGVYNTVLLAIGRDSCTRKMGLEKIGVKINEKSGKIPVNDVEQTSVPYVYAV
GDISEGKPELTPVAIQSGKLLARRLFGASLEKCDYINVPTTVFTPLEYGCCGLAEEKAIE
VYKKENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKLDHDRVIGFHILGPNAGEVTQGF
AAAMKCGLTKRLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGC
Download sequence
Identical sequences ENSPANP00000017527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]