SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017536 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017536
Domain Number 1 Region: 330-409
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000014
Family PHD domain 0.025
Further Details:      
 
Domain Number 2 Region: 746-789
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000173
Family PHD domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017536
Domain Number - Region: 459-494
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0201
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017536   Gene: ENSPANG00000007146   Transcript: ENSPANT00000014604
Sequence length 792
Comment pep:known_by_projection chromosome:PapAnu2.0:3:100005055:100085732:-1 gene:ENSPANG00000007146 transcript:ENSPANT00000014604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSHYVAQGCCSYLWIARLALRVDRSSKRRQVKPLAASLLEALDYDSSDDSDFKVGDASD
SEGSGNGSEDASKDSGEGSCSDSEENILEEELNEDIKVKEEQLKNSAEEVLSAEKQLIKM
EKKEEEENGERPRKKKEKEKEKEKEKEKEKEREKEKEKATVSENVAASAAATTPATSPPA
VNTSPSVPTATTAAEEQVSEPKKWNLRRNRPLLDFVSMEELNDMDDYDSEDDNDWRPTVV
KRKGRSASQKEGSDGDNEDDEDEGSGSDEDENDEGNDEDHSSPASEGGCKKKKSKVLSRN
SADDEELTNDSLTLSQSKSNEDSLILEKSQNWSSQKMDHILICCVCLGDNSEDADEIIQC
DNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVSPSCELCPNQDGIFKETD
AGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCD
AGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCK
MSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKL
MRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAE
QKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGIWALLGRITGQKLNIPAI
LRAPKERKPSKKEGGTQKTSTLPAVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPL
TRMPRKTKNSYW
Download sequence
Identical sequences ENSPANP00000017536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]