SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017552 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017552
Domain Number 1 Region: 21-147
Classification Level Classification E-value
Superfamily PX domain 3.27e-19
Family PX domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017552   Gene: ENSPANG00000008436   Transcript: ENSPANT00000016061
Sequence length 392
Comment pep:known_by_projection chromosome:PapAnu2.0:13:19649604:19683048:-1 gene:ENSPANG00000008436 transcript:ENSPANT00000016061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPE
DVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS
KDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEQQDQVAEEG
PPIQGLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAMKAKPSPRLTIFDEEVDPDQG
LFGLGRKQFPQGPSEDVSSVDPLKLFDDPDLSGAVPLGDSLLLPAACESGGPTPRLGHRD
ASKELFRVEEDLDQILNLGAEPKPKPQPKPKPPVAAKPAIPRKPAVPRKAGLAEAVAGQQ
KPQEQIQAMDEMDILQYIRDHDTPPQAAPSLF
Download sequence
Identical sequences A0A096NWW6
ENSPANP00000017552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]