SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017572 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017572
Domain Number 1 Region: 360-582
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-52
Family DBL homology domain (DH-domain) 0.0000901
Further Details:      
 
Domain Number 2 Region: 586-719
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-26
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 111-199
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000796
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017572   Gene: ENSPANG00000020173   Transcript: ENSPANT00000016177
Sequence length 1038
Comment pep:known_by_projection chromosome:PapAnu2.0:1:9322460:9353967:-1 gene:ENSPANG00000020173 transcript:ENSPANT00000016177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKGRASKVCHHADCQQLHRRGPLNLCEACDSKFHSAMHYDGHVRFDLPPQGSVLARNVS
TRSCPPRTSPAVDLEEEDEESSADGKGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDL
NVDIETDIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSLSFEAYRFGGHYL
RVKAKPGDEGKVEQGVKDSKSLSLPILRPAGTAPPALERVDPQSRRESLDILAPGRRRKN
MSEFLGEASIPGQEPPTPSSCSLPSGSSGSTSSGDSWKNRAASRFSGFFSSGPSTSAFGR
EVDKMEQLEGKLHTYSLFGLPRLPQRLRFDHDSWEEDDEDEDEDNACLRLEDSWRELIDG
HEKLTRRQCHQQEAVWELLHTEASYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSN
IPEIAQLHRRLWAGVMAPVLEKARLTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCM
EYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPR
AKEAVVTMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFL
HLDLTAPIPGASPEETRQLLLEGSLKMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTRV
IRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTIYNAQNQL
QQLRAQEPPGSQQPLQSLEEEEDEQEEEEEEEEEEGEESGNSAASSPTIMRKSSGSPDSQ
HCASDGSTETLAMVVVEPGETLSSPEFDGGPFSSQSDETSLSTIASSATPTSELLPLGPV
DGRSCSMDSAYGTLSPTSLQDFVAPGPVAELVPRPPDSPQAPSPPLSPRLRRRTPVQLLT
CPPQLLKSKSEASLLQLLVGTGTHGTSSAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWN
CRGGPSPGGGPRLASCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSTQHRKLTLAQL
YRIRTTLLLNSTLTASEV
Download sequence
Identical sequences ENSPANP00000017572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]