SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017595 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017595
Domain Number 1 Region: 764-832
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.64e-20
Family PHD domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017595
Domain Number - Region: 1043-1091
Classification Level Classification E-value
Superfamily Bromodomain 0.0322
Family Bromodomain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017595   Gene: ENSPANG00000021332   Transcript: ENSPANT00000013577
Sequence length 1099
Comment pep:known_by_projection chromosome:PapAnu2.0:7:91192950:91234702:-1 gene:ENSPANG00000021332 transcript:ENSPANT00000013577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECDDLKELPEPTPVKTRLPPEIFGDALMVLEFLNAFGELFDLQDEFPDGVTLEVLEEAL
VGNDSEGPLCELLFFFLTAIFQAIAEEEEEVAKEQLTDADTKDLTEALDEDADPTKSALS
AVASLAAAWPQLHQGCSLKSLDLDSCTLSEILRLHILASGADVTSANAKYRYQKRGGFDA
TDDACMELRLSNPSLVKKLSSTSVYDLTPGEKMKILHALCGKLLTLVSTRDFIEDYVDIL
RQAKQEFRELKAEQHRKEREEAAARIRKRKEEKLKEQEQKLKEKQEKLKEDEQRNSTADT
SIGEEEREDFDTSTESKDTEQKELDQDMVTEDEDDPGSHKRGRRGKRGQNGFKEFTRQEE
INCVTREPLTAEEDEALKQEHQRKEKELLEKIQSAIACTNIFPLGRDRMYRRYWIFPSIP
GLFIEEDYSGLTEDMLLPRPSSFQNNVQSQDPQVSTKTGEPLMSESTSNIEQGPRDHSVQ
LPKPVHKPNRWCFYSSCEQLDQLIEALNSRGHRESALKETLLQEKSRICAQLARFSEEKF
HFSDKPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLRDFLLDIEDRIYQGTLGAIKVT
DRYIWRSALESGRYELLSEENKENGIIKTVNEDVEEMEIDEQTKVIVKDRLLGIKTETPS
TVSTNASTPQSVSSVVHYLAMALFQIEQGIERRFLKAPLGNREINKDQKGDRKKKDKKKR
EEDQSSVRDDASDSGRSYKTILDRWRESLLSSASLSQVFLHLSTLDRSVIWSKSILNARC
KICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRPKQRPRRLSSRQRPS
LESDEDVEDSMGGEDDEVDGDEEEGQSEEEEYEVEQDEDDSQEEEEVSLPKRGRPQVRLP
VKTRGKLSSSFSSRGQRQEPGRYPSRSQQSTPKTTVSSKTGRSLRKISSAPPTETKSLRI
ASRSTRHSHGPLQADVFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSL
NVASKLSLQESESTRRCRKRQSPESSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDS
WPFLKLVSKIQLSLLMILS
Download sequence
Identical sequences ENSPANP00000017595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]