SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017636 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000017636
Domain Number - Region: 42-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000209
Family Elafin-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017636   Gene: ENSPANG00000020820   Transcript: ENSPANT00000006676
Sequence length 93
Comment pep:known_by_projection chromosome:PapAnu2.0:10:18556402:18560276:-1 gene:ENSPANG00000020820 transcript:ENSPANT00000006676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPVLPLQFLVVFCLALQLVPGSPKERVLKYILEPPPCISAPENCTQLCTMQEDCQKGFQ
CCSSFCGIVCSSDTLQKRKRYKPTGSEVIMPTN
Download sequence
Identical sequences A0A096NX46
ENSPANP00000017636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]