SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017652 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017652
Domain Number 1 Region: 158-267
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.95e-21
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 
Domain Number 2 Region: 302-505
Classification Level Classification E-value
Superfamily vWA-like 1.29e-20
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 3 Region: 19-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-17
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017652   Gene: ENSPANG00000015718   Transcript: ENSPANT00000002225
Sequence length 557
Comment pep:known_by_projection chromosome:PapAnu2.0:7:80791947:80796759:1 gene:ENSPANG00000015718 transcript:ENSPANT00000002225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERT
EVLRSCSSPVFSRVLALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQ
TKITKPLLLKNGKTAGKSTITIVAEEVSGTNDYVQLTFRAHKLDNKDLFSKSDPFMEIYK
TNGDQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIG
EFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIM
GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAF
GFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA
EPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMR
LLDGDDGPLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGIS
PGAPRPCTLATTPSPSP
Download sequence
Identical sequences A0A0D9RUJ3 A0A1D5QDU4 A0A2K6CI91 G7P9X1
ENSMMUP00000009657 ENSPANP00000017652 ENSMMUP00000009657 9544.ENSMMUP00000009657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]