SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017663 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017663
Domain Number 1 Region: 298-524
Classification Level Classification E-value
Superfamily vWA-like 3.08e-61
Family Integrin A (or I) domain 0.00035
Further Details:      
 
Domain Number 2 Region: 13-128
Classification Level Classification E-value
Superfamily vWA-like 1.03e-30
Family Integrin A (or I) domain 0.0019
Further Details:      
 
Domain Number 3 Region: 216-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000232
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 254-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000262
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 534-574
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000000051
Family Chicken cartilage matrix protein 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017663   Gene: ENSPANG00000009740   Transcript: ENSPANT00000012433
Sequence length 578
Comment pep:known chromosome:PapAnu2.0:10:18949220:18964341:1 gene:ENSPANG00000009740 transcript:ENSPANT00000012433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLCWLVLLFLLQPWESQLQLAGPRCHTGPLDLVFVIDSSRSVRPFEFETMRQFLVGL
LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYA
MNVAFARRARLPRRVLRPHPGVRPAVPEPAVCPVCPQGRTKSCSVAQARVQWCDLGSLQA
PTTTPSYFFVFLVETNTLLMELGFLLSAKHCAIDLCAEGTHGCEHHCVNSPGSYFCRCQV
GFVLQPDQRSCRAIDYCSFGNHSCQHECVSTPGGPRCHCREGHDLQPDGRSCQVRDLCNG
VDHGCEFQCVSEGLSYHCLCPEGRQLQADGKSCDRCREGHVDLVLLVDGSKSVRPQNFEL
VKRFVNQIVDFLDVSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTM
TGLALRHMVEHSFSEAQGARPRALNVPRVGLVFTDGRSQDDISVWAARAKEEGIVMYAVG
VGKAVEAELREIASEPAELHVSYAPDFGTMTHLLQNLRGSICPEEGISAGTELRSPCECE
SLVEFQGRTLGALESLTLNLAQLTARLEHLENQLANQK
Download sequence
Identical sequences ENSPANP00000017663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]