SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017676 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017676
Domain Number 1 Region: 190-307
Classification Level Classification E-value
Superfamily TPR-like 3.59e-29
Family Tetratricopeptide repeat (TPR) 0.00068
Further Details:      
 
Domain Number 2 Region: 5-125
Classification Level Classification E-value
Superfamily TPR-like 8.44e-24
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017676   Gene: ENSPANG00000024779   Transcript: ENSPANT00000023281
Sequence length 309
Comment pep:known_by_projection chromosome:PapAnu2.0:10:19281979:19299247:1 gene:ENSPANG00000024779 transcript:ENSPANT00000023281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKFPDSVEKLRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLFSNRAAC
HLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDNSVTS
ALEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHREMAKSKSKATTAT
KNRVPSAGDVEKAKVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVL
KQYTEAVKDCTEAIKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKL
RQEVKQNLH
Download sequence
Identical sequences A0A096NX82
ENSPANP00000017676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]