SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017701 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017701
Domain Number 1 Region: 255-564
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-116
Family Transglutaminase core 0.0000000184
Further Details:      
 
Domain Number 2 Region: 83-254
Classification Level Classification E-value
Superfamily E set domains 1.22e-45
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 578-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.33e-30
Family Transglutaminase, two C-terminal domains 0.00046
Further Details:      
 
Domain Number 4 Region: 690-789
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017701   Gene: ENSPANG00000021783   Transcript: ENSPANT00000007302
Sequence length 818
Comment pep:known_by_projection chromosome:PapAnu2.0:7:80973196:80987034:-1 gene:ENSPANG00000021783 transcript:ENSPANT00000007302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRFRRGGGGRSFWARCCGCCSCRNVADD
DWGPEPSDSRGRGSSSGTRRPGSRGSDSRQPVSRGSGVNAAGDGTIREGMLVVTGVDLLS
SRSDQNRQEHHTDEYEYDELIVRRGQPFRMLLLLSRTYESSDRITLELLIGNNPEVGKGT
HVIIPVGKGGSGGWKAQVTKASGQTLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDP
RNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLD
ACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSV
EILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDE
NMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVES
IKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMRED
ITYLYKHPEGSDAERKAVETAAAHGSKPNVYASRGSAEDVAMQVEAQDAVMGQDLMVSVM
LTNHSSSRRTVKLHLYLSVTFYTGVTGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHL
VDQGSMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPV
TLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVH
GVIQVDVAPAPGDRGFFSDTGGDSHLGETIPMASRGGA
Download sequence
Identical sequences A0A096NXA7
ENSPANP00000017701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]