SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017718 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017718
Domain Number 1 Region: 1058-1258
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.52e-27
Family Reverse transcriptase 0.0018
Further Details:      
 
Domain Number 2 Region: 1602-1692
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000228
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 1315-1444
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000733
Family Ribonuclease H 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017718   Gene: ENSPANG00000018562   Transcript: ENSPANT00000011325
Sequence length 1892
Comment pep:known_by_projection chromosome:PapAnu2.0:7:81122975:81142728:1 gene:ENSPANG00000018562 transcript:ENSPANT00000011325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGGDPPAQEWFMVQTKSKPRVQRQRLQVQRIFRVKLNAFQSRPDTPYFWLQLEGPRE
NMGKAKEYLKGLCNPELWKEVRYPPILHCAFLGAQGLFLDCLCWSTLAYLVPGPPGSLMV
GGLTESFIMTQNWLEELVGRLRWGPAPLLTPRGIWEAEVTRAFGALVWIRGDQHAGDLLQ
LPPAVQELLLSLVRDAAGKEDIIEWLSRFGISDSHSDPEVLICPSQQQKEAPAMVSVGES
PGPFVDMGTLQNRVPENSKRLSSLGATGSLIPAQSTPQEAANQLVRVGSNSQGGMDSAQE
EGPVQATSSQDSTNHTQALLKQKQVQRIEDKLLFQPPVSALGVCPSWKAWTPGPAFGPLW
PGAIAATFWRINELHSLHLAWLLSQACFNFPFWQRPLGPIQLKLPGQNPLPLNLEWKQKE
LAPLPSAESPAGRPDGGLGGEAALQNCPRPEIPPKVTSLLVVPGSSDVKDKVSSDLPQIG
PPLTSTPQLQAGGESGDQGSMQLDCKGLEEGPAPVLPAGQGKPMAQGELTDQSVPGAQTV
PETLKVPMAAAVPKAENPPRTQVPPAAPKVPTSQVMPAVHTEPAAPKVPSAPTKPAAQMM
ATAQKTVVNQPVLAAQVEPTTPKTPQAQKMPVAKTSPAGPKTPKAQAGAAATVSKAPAAP
KVPVTPKVSRAPKTPAAQKVPMDAGPTLDVAKLLSEVQPTSRASASLLKGQGQAGRQGPQ
PSGTLALSSKHQFQMEGLLGAWEGAPRQPPHHLQTNNTVTSFQRYHEALNTPFELNLSGE
PGNQGLRRVVIDGSSVAMVHGLQHFFSCRGIAMAVQFFWNRGHREVTVFVPTWQLKKNRR
VRESHFLTKLHSLKMLSITPSQLENGKKITTYDYRFMVKLAEETDGIIVTNEQIHILMNN
SKKLMVKDRLLPFTFAGNLFMVPDDPLGRDGPTLDEFLKKPNRLDTDIGNFLKVWKTLPP
SSASVTELSDDADSGPLESPPNMEEDREEKEERQDEEQRQGQGMQKAAEEDDLDSSLASV
FRVECPSLSEEILRCLSLHDPPDGALDIDLLPGAASPYLGIPWDGQAPCQQVLAHLAQLT
IPSNFTALSFFVGFMDSHRDAIPDYEALVGPLHSLLKQKPDWQWDQEHEEAFLALKRALV
SALCLTAPNSQLPFRLEVTVSHVALTAILHQEHSGRKHPIAYTSKPLLPDEESQGPQSGG
DSPYAVAWALKHFSRCIGDTPVVLDLSYASRTMVDPEVREGRRFSKAWLIRWSLLVQDKG
KRALELALLQGLLGENRLLTPAASMPRFFQVLPPFSDLSTFVCIHMSGYCFYREDEWCAG
FGLYVLSPTSPPVSLSFSCSPYTPTYAHLAAVACGLERFGQSPLPVVFLTHCNWIFSLLW
ELLPLWRARGFLSSDGAPLPHPSLLSYIISLTSGLSSLPFIYRTSYRGSLFAVTVDTLAK
QGAQGGGQWWSLPKDVPAPTVTPHAMGKRPNLLALQLSDSTLADIIARLQAGQKLSGSSP
FSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDIPLGAHQRPEETYKKL
RLLGWWPGMQEHVRDYCRSCLFCIPRNLIGSELKVIESPWPLRSTAPWSNLQIEVVGPVT
ISEEGHKHVLIVADPNTRWVEAFPLKPYTHTAVAQVLLQHVFARWGVPVRLEAAQGPQFA
RHVLVSCGLALGAQVASLSRDLQFPCLTSSGAYWEFKRALKEFIFLHGKKWAASLPLLHL
AFRASSTDATPFKVLTGGESRLTEPLWWEMSSANIEGLKMDVFLLQLIGELLELHWRVAD
KASEKAENRRFKRESQEKEWNVGDQVLLLSLPRNGSSAKWVGPFYIGDRLSLSLYRIWGF
PTPEKLGCIYPSSLMKAFAKSGTPLSFKVLEQ
Download sequence
Identical sequences A0A096NXC4
ENSPANP00000017718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]