SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017738 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017738
Domain Number 1 Region: 344-691
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.19e-39
Family Hect, E3 ligase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.32e-28
Family PHD domain 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017738
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00496
Family PHD domain 0.02
Further Details:      
 
Domain Number - Region: 67-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0184
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017738   Gene: ENSPANG00000015300   Transcript: ENSPANT00000015728
Sequence length 706
Comment pep:known_by_projection chromosome:PapAnu2.0:7:87208000:87264741:1 gene:ENSPANG00000015300 transcript:ENSPANT00000015728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENKPGDSQNLACVFCRKNDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNF
ASFCWNHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTICSNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHHERCDVRRCRC
KEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKK
HVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLLIELGFQIKKK
TKRLYINKANIWTSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPE
NTQPILDDVSDFDVAQIIIRINTATTVADLKSVINECYNYLELIGCLRLITTLSDKYMLV
KDILVYHVIQRVQAPFESFKQGLKTLGVLEKIQAYPEAFCSILCYKPESLSAKILSDLFT
VHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDF
PVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLKLEKEESSHYIGH
Download sequence
Identical sequences ENSPANP00000017738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]