SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017765 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017765
Domain Number 1 Region: 350-620
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-82
Family Protein kinases, catalytic subunit 0.0000000000891
Further Details:      
 
Domain Number 2 Region: 237-381
Classification Level Classification E-value
Superfamily SH2 domain 4.25e-39
Family SH2 domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 155-247
Classification Level Classification E-value
Superfamily SH3-domain 4.41e-25
Family SH3-domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017765   Gene: ENSPANG00000015298   Transcript: ENSPANT00000007201
Sequence length 627
Comment pep:known_by_projection chromosome:PapAnu2.0:10:26770617:26794803:-1 gene:ENSPANG00000015298 transcript:ENSPANT00000007201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDWRVDAIGISLSNDILKTVLRCLLYPCFADEDTEAQRGEVTCLGTHSGERWRRASSS
RPLTSHLVFVPRLQAASQVLWDSPCLLPARTMGSNKSKPKDASQRRRSLEPAENAHGAGG
GAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTF
VALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAE
EWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRK
LDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRES
LRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLY
AVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRD
LRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVW
SFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEER
PTFEYLQAFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences A0A096NXH1
ENSPANP00000017765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]