SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017781 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000017781
Domain Number - Region: 278-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000152
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 216-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 183-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000872
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 247-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00139
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 312-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00774
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017781   Gene: ENSPANG00000011642   Transcript: ENSPANT00000029273
Sequence length 381
Comment pep:known_by_projection chromosome:PapAnu2.0:11:60493338:60565280:-1 gene:ENSPANG00000011642 transcript:ENSPANT00000029273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSAFAAAALWLWSILLCLLALRAEAGQPREESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQG
EAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYG
VNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSK
GYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYGASLIHALRPAGAQLRQ
HTPSLKKAEERRDPPESNYIW
Download sequence
Identical sequences ENSPANP00000017781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]