SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017789 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017789
Domain Number 1 Region: 240-309
Classification Level Classification E-value
Superfamily Homeodomain-like 1.97e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000303
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 46-77
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000286
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017789
Domain Number - Region: 142-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00285
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017789   Gene: ENSPANG00000021346   Transcript: ENSPANT00000013640
Sequence length 382
Comment pep:known_by_projection chromosome:PapAnu2.0:1:166029496:166040895:-1 gene:ENSPANG00000021346 transcript:ENSPANT00000013640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKIS
DRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLG
ISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQL
SYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSVTATGCNENEADHLD
RDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWF
QNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTS
VTSNMDSHESGSPSQTTLTNLF
Download sequence
Identical sequences ENSPANP00000017789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]