SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017808 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017808
Domain Number 1 Region: 56-216
Classification Level Classification E-value
Superfamily EF-hand 5.83e-42
Family Penta-EF-hand proteins 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017808   Gene: ENSPANG00000023830   Transcript: ENSPANT00000016116
Sequence length 218
Comment pep:known_by_projection chromosome:PapAnu2.0:12:24221990:24239818:1 gene:ENSPANG00000023830 transcript:ENSPANT00000016116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGYGGGFGNFSIQVPGIQMEQPVPETGPAVLLDEYCGFPAFSDAYSSAGDSVYTYFS
TVAGQDGELDAEELQRCLTQSGISGTYSPFSLETCRIMIAMLDRDYTGKLGFSEFKELWA
ALNAWKQNFMTVDQDGSGTVEHHELRQAIGLMGYRLSSQTITTIVKRYSKNGRIFFDDYV
ACCVKLRALTDFFRKRDHLQQGSVNFMYDDFLQGTMAI
Download sequence
Identical sequences A0A096NXL3
ENSPANP00000017808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]