SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017826 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017826
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 1.86e-19
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000473
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017826
Domain Number - Region: 248-303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00111
Family SPRY domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017826   Gene: ENSPANG00000011942   Transcript: ENSPANT00000012742
Sequence length 304
Comment pep:novel chromosome:PapAnu2.0:14:79761149:79786532:-1 gene:ENSPANG00000011942 transcript:ENSPANT00000012742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYSLQAFQNELICSICMNYFIDPVTIDCGHSFCRPCLCLCWEEGRAPVRCPECGEISA
KSDFNTNAALKKLASLARVRRLQNINNSHSICVLHKETKELFCEADKRLLCGPCSESPEH
MAHSHNPIGWAAEECREKLIKKMNSLWKINQETQNNLSQETSKFRSLADYVSLRKVIITT
QYQKMHLHLHEEEQLHLQALEREAKELFQQLQDTQDVRNVSARADLAQMQKPQPVNPELT
SWRITGVLDMLNNFRVDNALSTEMTPCYISLSEDVRRVIFGVDHRSAPMDPQGVESFAVW
GAQA
Download sequence
Identical sequences ENSPANP00000017826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]