SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017828 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017828
Domain Number 1 Region: 443-500
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 7.72e-18
Family Rabenosyn-5 Rab-binding domain-like 0.000036
Further Details:      
 
Domain Number 2 Region: 723-781
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 7.98e-17
Family Rabenosyn-5 Rab-binding domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 153-199,244-280
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017828   Gene: ENSPANG00000016555   Transcript: ENSPANT00000009020
Sequence length 785
Comment pep:known_by_projection chromosome:PapAnu2.0:11:83015223:83040675:-1 gene:ENSPANG00000016555 transcript:ENSPANT00000009020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKD
RLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVE
VNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCR
LCGSIMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSISSVSSV
LDEKDDDRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMA
ASLNAGETTYSLEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPSNLRLQRMIRY
SATLFVQEKLLGLMSLPTKEQFEELKKKRKEEMERKRAMERQAALESQRRLEERQSGLAS
RAANGEVASLRRGSAPLRKAEGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRTD
EVRTLQENLRQLQDEYDQQQTEKAIELSRRQAEEEDLQREQLQMLRERELEREREQFRVA
SLHTRTRSLDFREIGPFQLEPSREPRTHLAYALDLGSSPVPSNTAPKTPSPSSTQQPTRV
WSGPPALGQELLTQSSMPQQHEGPSLNPFDEEDLSSPMEEGTTSPPAAGVSFDPSARMLK
EYNPFEEEDGEEEAVAGNPFIQPDSPALNPFNEEDEHPQQRPSSPLVPGNPFEEPTCTNP
FEMDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLAKQ
KGGTD
Download sequence
Identical sequences A0A096NXM7
ENSPANP00000017828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]