SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017843 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017843
Domain Number 1 Region: 193-356
Classification Level Classification E-value
Superfamily EF-hand 7.05e-23
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 2 Region: 96-164
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000298
Family Polcalcin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017843   Gene: ENSPANG00000013126   Transcript: ENSPANT00000009028
Sequence length 362
Comment pep:known_by_projection chromosome:PapAnu2.0:1:4213272:4228843:-1 gene:ENSPANG00000013126 transcript:ENSPANT00000009028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWSWVAMASRWGPLVGLAPRCLWLLGAVLLMDASARPANHSSTRERVANREENEILPPD
HLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDVEPRRSRRKLMVIFSKVDVNTDRKISA
KEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVANA
IRLNEELKVDEETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKE
IVRDLDQDGDKQLSLPEFVSLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
EELESYMDPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHE
EF
Download sequence
Identical sequences A0A096NXP2
ENSPANP00000017843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]