SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017872 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017872
Domain Number 1 Region: 74-287
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 272-426
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 3 Region: 3-90
Classification Level Classification E-value
Superfamily SH3-domain 1.26e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017872   Gene: ENSPANG00000009684   Transcript: ENSPANT00000013152
Sequence length 517
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684984.1:84307:175727:1 gene:ENSPANG00000009684 transcript:ENSPANT00000013152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGPSDVQN
GHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFS
DEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNH
LDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTA
QDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIY
TGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRD
DDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISENQ
KRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQ
SPFWQNFSREPFSWIDLEQQKGYKGIRMNSAVESKPL
Download sequence
Identical sequences A0A2I3LNH1
ENSPANP00000017872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]