SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017875 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017875
Domain Number 1 Region: 418-487,524-737
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000357
Family Rhodopsin-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017875
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017875   Gene: ENSPANG00000006084   Transcript: ENSPANT00000021530
Sequence length 796
Comment pep:known_by_projection chromosome:PapAnu2.0:2:20525746:20601964:1 gene:ENSPANG00000006084 transcript:ENSPANT00000021530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCRAWNIRVLVAVVCGLLTGIILGLGIWRIVIRIQRGISATSSSTPTEFCRNGGTWEN
GRCVCTEEWKGLRCTIANFCEKSTYMGFTFARIPVGRYGPSLQTCGKGTPNAGNPMAVRL
CSLSPYGEIELQNVTIGNCNENLETLEEQVKDVTAPLNNISSEVQILTSDANKLTAENIS
SATRVVGQIFNTSRNASPEAKKIAIVTVSQLLDASGDAFQEAAATANNDALTTLIEQMET
YSLSLGNESVVEPNIAIQSANFSSKDAVGPLNVRFSVQKGASSSLLSGSTFIHTNVDGLN
PDGQTELQVLLNMTKSNSKACGFVVYQNDKLFQSKTFTAKSNFSQKIISSKTDENEQDQS
ASVDMVFSPRYNQREFQLYSYACVYWNLSTRDWDTYGCQKHKGTDGFLRCHCNHTTNFAV
LMTFKKDYQYPKSLDVFSNVGCALSITGLALTIVFQIVTRKVRKTSVTWVLVNLCISMLI
FNLLFVFGIENSNKNKTSDGDIHDIDFKNNDVPQTDTINDSNPTCTAIAALLHYFLLVTF
TWNALSAAQLYFLLIRTMKPLPRHFILFISLIGWGVPAIVVAITVGVIYSQNGKNPQWEL
DYRQEIICWLAIPEPDGVTKSPLLWSFILPVTIILISNVVIFITISIKVLWKNNQNLTST
KKVSSMRKIVSTLSVAVVFGITWILAYLMLVNDDSIRIIFSYIFCLFNTTQGVQIFFLHT
VRTKIFQTEASKVLTLLLSIGRRKSLSSVTRPRLRVRMYNFLRSLPTLHEHFRLLETSRS
TEDITFSESDKAKESI
Download sequence
Identical sequences A0A096NXS3
ENSPANP00000017875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]