SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017922 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017922
Domain Number 1 Region: 54-184,215-332
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.43e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 622-696
Classification Level Classification E-value
Superfamily EF-hand 1.33e-17
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 3 Region: 313-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000981
Family D-aminoacid oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017922   Gene: ENSPANG00000022223   Transcript: ENSPANT00000009577
Sequence length 730
Comment pep:known_by_projection chromosome:PapAnu2.0:12:18419246:18527547:1 gene:ENSPANG00000022223 transcript:ENSPANT00000009577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADYISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGYTGLKTALVERDDFSSGTSSRSTKLIHG
GVRYLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGI
KLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAA
RYGAATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSV
RKMDDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDT
PTDVTPHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSIS
RNHVVDISESGLITIAGGKWTTYRSMAEDTINAAIKTHNLKAGPSRTVGLFLQGGKDWSP
TLYIRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEV
KYGIKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDHKKQEQLETARK
FLYYEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADKKGFITIVDVQRVLESINV
QMDENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVP
IPVDRSCGGF
Download sequence
Identical sequences ENSPANP00000017922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]