SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017931 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017931
Domain Number 1 Region: 444-561
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.46e-26
Family Protein kinases, catalytic subunit 0.000000616
Further Details:      
 
Domain Number 2 Region: 110-182
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 182-235
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000299
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017931   Gene: ENSPANG00000004965   Transcript: ENSPANT00000004911
Sequence length 588
Comment pep:known_by_projection chromosome:PapAnu2.0:3:162535458:162693254:-1 gene:ENSPANG00000004965 transcript:ENSPANT00000004911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGN
GTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQ
RTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVE
VLENVPLTTHNFXRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQ
LDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPTSDSLGPQILTSPSPSKSIPIPQP
FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGAPLNQLMRCLRKY
QSRTPSPLLHSVPSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKML
NVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE
TKFEMIKLIDIARQTAQGMEHQKSSECKIKIHTAFSQMYMHLGLFCMN
Download sequence
Identical sequences ENSPANP00000017931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]