SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Papio anubis 76 > ENSPANP00000017959

Domain assignment for ENSPANP00000017959 from Papio anubis 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSPANP00000017959
Domain Number 1 Region: 491-560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-19
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 2 Region: 683-745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 3 Region: 375-438
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-16
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 4 Region: 140-211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000001
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 5 Region: 315-385
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000122
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 6 Region: 817-881
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 7 Region: 566-631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000124
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 8 Region: 2-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000903
Family Complement control module/SCR domain 0.0000441
Further Details:      
 
Domain Number 9 Region: 871-935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 752-811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000514
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 11 Region: 69-132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000124
Family Complement control module/SCR domain 0.0000314
Further Details:      
 
Domain Number 12 Region: 196-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 647-694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000514
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 14 Region: 453-502
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000032
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 15 Region: 280-309
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000306
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017959   Gene: ENSPANG00000014170   Transcript: ENSPANT00000019496
Sequence length 999
Comment pep:known_by_projection chromosome:PapAnu2.0:1:156451211:156470213:-1 gene:ENSPANG00000014170 transcript:ENSPANT00000019496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
GISCGSPPPILNGRISDYSTPITLGTVIRYICSNGFRLIGEKNTICITKDKVVGIWDKPA
PKCEYFNKYSTCPEPIVPGGYKTRGSVPPYRHGDFVTFACKTNFSMNGNKSVWCQANNRW
GPTRLPTCESVCVCKVFPLECPALPMIHNGHHTSENVSSIAPGLSVTYSCESGYLLVGEK
IINCLSSGKWSAVPPTCEEARCKPLGRFPNGKVKEPPILQVGVTANFFCDEGYQLQGPSS
SRCVIAGQGVAWTKMPVCKGRLGNDGLTALHSQSLPYGLNFILIGENTLRCTVDSQKTGT
WSGPAPRCELSTSAVQCPRPQILRGRIVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCN
AKGTWEPSAPVCEKECQAPPNILNGQKEDRHMVRFNPGTSIKYSCNPGYVLVGEESIQCT
SEGVWTPPVPQCKVAVCEATGKQLLTKPQHQFIRPHVNSSCDEGYKLSGSVYQECQGTTP
WFMEIRLCKEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPEREVEFSLIGESTI
RCTSNDQERGTWSGPAPLCELSLLAVQCSHVHVANGYKISGKEPPYFYNDTVTFKCFNGF
TLKGSSQIRCKANNTWDPEIPVCEKETCQPVREDLQELPVGSRLELVNTSCQDGYWLTGH
TYHKCQDDENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYL
LGEKKLQCRSDSKGHGSWSGPSPQCLQSPPVTSCPNPEVKHGYKLNKTLSAYSHDDIVYV
DCHPGFIMNGSRMIRCHTDNTWVPGVPTCIKKAFVGCQPPPKTPNGNHTGGNIARFSPGM
SILYSCDQGYLLVGEALLLCTHEGTWNRPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYG
AVVTLECEDGYMLEGSSQSQCQADHQWNPPLAVCRSRSLAPVLSGIAAGLILLIFLIVVT
LCMISKHRERNYYTNTSQKEAFRLEAREVYSIDPYNPAS
Download sequence
Identical sequences ENSPANP00000017959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.