SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017966 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017966
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000011
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017966   Gene: ENSPANG00000007685   Transcript: ENSPANT00000004606
Sequence length 487
Comment pep:known_by_projection chromosome:PapAnu2.0:18:16223956:16249667:1 gene:ENSPANG00000007685 transcript:ENSPANT00000004606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSDINQFAAAYFQELTMYRGNTTVDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLKEPEKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAEPGAEQTEAVGDSSSKPATPKATTPPSSPPPTAVSPEFAYVPADPAQLAAQML
GKVSSIHSDQSDVLMVDVATSMPVVIEEVPSSEAAEDIMVAAPLVCSGKVLEVQVVSQTS
VHVDLGSQPKENEAEQSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDV
PVIEGVVYIEQLPEQIVTPFTDQVACPKENEQSPPVSPKSVVEKTTSGISKISVESVELA
QLEENAKYSSVYTEAEAAALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLEVGITSI
VSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEP
EGEATAE
Download sequence
Identical sequences A0A096NY06
ENSPANP00000017966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]