SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017977 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017977
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-34
Family Single strand DNA-binding domain, SSB 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017977   Gene: ENSPANG00000017691   Transcript: ENSPANT00000020547
Sequence length 204
Comment pep:known_by_projection chromosome:PapAnu2.0:12:53411690:53418991:1 gene:ENSPANG00000017691 transcript:ENSPANT00000020547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWD
EIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYR
GQQNKGAQSEQKNNSMNNNMGTGTFGPVGNGVYTGPESRGHQFSHAGRSNGRGPINPQLQ
GTASNQTVMTTISNGRDPRRAFKR
Download sequence
Identical sequences A0A096NY17
ENSPANP00000017977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]