SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018010 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018010
Domain Number 1 Region: 200-396
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000523
Family BAR domain 0.048
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018010
Domain Number - Region: 81-100,130-165
Classification Level Classification E-value
Superfamily PX domain 0.0201
Family PX domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018010   Gene: ENSPANG00000022563   Transcript: ENSPANT00000013574
Sequence length 400
Comment pep:known_by_projection chromosome:PapAnu2.0:7:90998647:91071021:-1 gene:ENSPANG00000022563 transcript:ENSPANT00000013574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSKFNFFQI
FISIFYHSCHFQFHFSFVQAGVIHPPWPPKPLFQKKKKKKEKTITGSSSVTQAGVQQRKE
EREIIEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDVSIKLIGKSQQIET
ILSNMVKPPDGIVWPGSSDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYN
RIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAA
KDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFK
TRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
Download sequence
Identical sequences ENSPANP00000018010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]