SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018029 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018029
Domain Number 1 Region: 329-690
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.88e-119
Family Oxysterol-binding protein 0.0000102
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily PH domain-like 0.0000661
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018029   Gene: ENSPANG00000005884   Transcript: ENSPANT00000027412
Sequence length 696
Comment pep:known_by_projection chromosome:PapAnu2.0:1:53792107:53953008:1 gene:ENSPANG00000005884 transcript:ENSPANT00000027412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSRRGCVRLRGAVIGIDDEDDSTFTITVDQKTFHFQGDFIDARDADEREKWIHALEET
ILRHTLQLQGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKVIDLDKKQNITKKKIETLK
ETTNSMVESIKHCIVLLQIAKDQSNVEKHADGMISTINPVDAIYQPSPLEPVISTMPSQT
VLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSP
NTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLN
SSMSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILER
RSLLEMYADFFAHPDLFVSISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGE
IFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFN
AHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNIN
CSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTV
FVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDIDAATEAKHRLEERQRAEAR
ERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences ENSPANP00000018029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]