SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018034 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018034
Domain Number 1 Region: 184-378
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.72e-48
Family Reprolysin-like 0.00025
Further Details:      
 
Domain Number 2 Region: 399-476
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 9.42e-17
Family Blood coagulation inhibitor (disintegrin) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018034   Gene: ENSPANG00000013368   Transcript: ENSPANT00000019716
Sequence length 746
Comment pep:known_by_projection chromosome:PapAnu2.0:8:37795218:37940943:1 gene:ENSPANG00000013368 transcript:ENSPANT00000019716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFLLALLTELGRLQAHVGSEGIFLHVTVPRKILLNDSEVSERKMIYIITIDGQPYTLHL
RKQSFLPQNFLVYTYNEAGSLHSESPYFMMHCHYQGYAAEFPDSFVTLSICSGLRGFLQF
ENVSYGIEPLESSARFEHIIYQLKNNDPNVSILAENYSHIWQKDQSYKVPLNSQKVNKTR
NLPFFTKLYIYMQKGIYDYMGSEMMAVTQKIVQVIGLVNTMFTQFRLTVILSSLELWSNE
NQISTSGDADDILQRFLAWKRDYLILRPHDIAYLLVYRKHPKYVGATFPGTICNESYDAG
IAMYPDAIDLEGFSVIIAQLLGLNVGLTYDDITQCFCLRATCIMNHEAVSARGIKIFSNC
SMHDYRYFVSKFEAKCLQKVSNLQPLHQNQPVCGNGILESNEECDCGNKKECQFKKCCDY
NTCKLKGSVKCGSGPCCTSKCELSIVGTPCRKSVDPECDFTEYCNGTSSDCVPDTYALNG
HLCKLGTAYCYNGQCQTTDNQCAKIFGKGAQGAPFACFKEVNSLHERSENCGFKNSQPLP
CERKDILCGKLACVQPHKNAYKSDIQYTVYSYIQDHVCVSIATGSSMRSDGTDNAYVADG
TMCGPEMYCVNKTCRKVHLTGYNCNTTTKCKGKGICNNFGNCQCFPGHKPPDCKFQFGSP
GGSIDDGNFQKSDEFYTEKGYNAHWNNWFILSFYIVLPFFIIFTIVIFKRNEIRKLCNRE
NTELIHPLYQKAMMWNINIAQNFRSK
Download sequence
Identical sequences ENSPANP00000018034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]