SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018076 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018076
Domain Number 1 Region: 521-842
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.55e-109
Family PDEase 0.0000000000121
Further Details:      
 
Domain Number 2 Region: 132-326
Classification Level Classification E-value
Superfamily GAF domain-like 2.12e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 312-516
Classification Level Classification E-value
Superfamily GAF domain-like 1.35e-37
Family GAF domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018076   Gene: ENSPANG00000011908   Transcript: ENSPANT00000025103
Sequence length 860
Comment pep:known_by_projection chromosome:PapAnu2.0:5:110191358:110315465:-1 gene:ENSPANG00000011908 transcript:ENSPANT00000025103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAGPSFGRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGH
TESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMP
LTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCEDSS
NDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPRFNAEV
DQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLH
NAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDED
CSDSFSSVFHMECEELEKSSDMLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPW
TTENTGNVSQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAF
VIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLK
ITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNW
RHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQL
YCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEF
FELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVASEFFDQGDRERK
ELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQA
LAEQQEKMLINGESGQAKRN
Download sequence
Identical sequences ENSPANP00000018076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]