SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018160 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018160
Domain Number 1 Region: 489-565,728-861
Classification Level Classification E-value
Superfamily TPR-like 8.15e-22
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number 2 Region: 884-1051
Classification Level Classification E-value
Superfamily TPR-like 1.1e-21
Family Tetratricopeptide repeat (TPR) 0.0076
Further Details:      
 
Domain Number 3 Region: 108-238
Classification Level Classification E-value
Superfamily TPR-like 2.56e-18
Family Tetratricopeptide repeat (TPR) 0.067
Further Details:      
 
Domain Number 4 Region: 180-383
Classification Level Classification E-value
Superfamily HCP-like 0.0000000000118
Family HCP-like 0.025
Further Details:      
 
Domain Number 5 Region: 661-754
Classification Level Classification E-value
Superfamily TPR-like 0.0000000379
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018160
Domain Number - Region: 561-701
Classification Level Classification E-value
Superfamily TPR-like 0.000129
Family BTAD-like 0.056
Further Details:      
 
Domain Number - Region: 40-139
Classification Level Classification E-value
Superfamily HCP-like 0.00262
Family HCP-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018160   Gene: ENSPANG00000000721   Transcript: ENSPANT00000005788
Sequence length 1168
Comment pep:known_by_projection chromosome:PapAnu2.0:12:27827867:27893756:-1 gene:ENSPANG00000000721 transcript:ENSPANT00000005788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQELKTLINYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREF
EAIKNKQDVSLCSLIALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWH
IGRHDKAREYIDRMIKMSDGSKQGHVLKAWLDITRGKDPYTKKALKYFEEGLQDGNDTFA
LLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLL
QDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNAQLFYNITLAFSRTCG
RSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSA
LVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLN
DVLDTHFSQIEGLPLGIQYFEKLNPDFLLEIVTEYLSFCPIQPASPGQPLCPLLRRCVSV
LETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQE
KVKLCSQSLELCLSYDFKVREYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGA
STKSKDRNTEVDTSHRLSIFLELIELHRLNGEQHEAAKVLQDAIHEFSGTSEEVRVTIAN
ADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMA
NPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYE
TALKSGQKNYLCYDLAELLLKLKWYDKAEKVLQHALAHEPVNELSALMEDGRCQVLLAKV
YSKMERPGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDY
EKAIKFYREALVHCETDIKIMLELARLYLAQDDPDSCLRQCALLLQSDQDNEAATMMMAD
LMFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAK
LEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETIGGEVF
ENLDGDLGNSTEKQESVQLAVRTAEKLLKELKPQTVEGHVQLRIMENYCLMATKQKSNVE
QALNTFTEIAASEVSGFSFSASYVIFIW
Download sequence
Identical sequences ENSPANP00000018160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]