SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018199 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018199
Domain Number 1 Region: 6-412
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-102
Family Ras GEF 0.00026
Further Details:      
 
Domain Number 2 Region: 484-544
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 418-481
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000242
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018199   Gene: ENSPANG00000007703   Transcript: ENSPANT00000000527
Sequence length 690
Comment pep:known_by_projection chromosome:PapAnu2.0:13:32513902:32563947:1 gene:ENSPANG00000007703 transcript:ENSPANT00000000527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLGKAATLDELLHTCIEMFDDNGELNNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMRSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG
Download sequence
Identical sequences A0A096NYN6
ENSPANP00000018199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]