SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018202 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018202
Domain Number 1 Region: 17-317
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.98e-35
Family WD40-repeat 0.0066
Further Details:      
 
Domain Number 2 Region: 919-1162
Classification Level Classification E-value
Superfamily ARM repeat 0.0000282
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 
Domain Number 3 Region: 1266-1379
Classification Level Classification E-value
Superfamily TPR-like 0.0000759
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018202
Domain Number - Region: 249-306,333-425,452-500
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000102
Family YVTN repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018202   Gene: ENSPANG00000022799   Transcript: ENSPANT00000026777
Sequence length 1752
Comment pep:known_by_projection chromosome:PapAnu2.0:13:26477308:26523420:-1 gene:ENSPANG00000022799 transcript:ENSPANT00000026777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADM
KYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQW
PAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYF
FDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQE
REFTTAVASPGGQSVVLGSYDRLRVFNWSPQRSIWEEAKPKEIANLYTITALAWKRDGSR
LCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEV
KILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLV
EYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIG
TMSHESRVDWLELNETGHKLLFRDRKLRVSLYYLSLCPQLLLIYFVPFTEEWIPGLICLF
LREKGRIWVGNSSISPSNALKSMFQVQGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLI
EFGTAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEARQLHIAERCFSALGQVAKA
RFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQE
LHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAG
LPAKAARLVLTREELLANTELVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGNA
FMKAVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWK
KAIYILDLQDRNTASKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQA
HKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVEEPDLAITMYKKHKLYDDMI
RLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYRV
ARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLAL
KHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPD
SVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQL
EALQEEYEREATKKGARGVEGLVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMK
AAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKA
KRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQ
NYKILHKYVALYATHLIREGNSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCA
EAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVA
ARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWENMAFIFLNRFLDLTDAIEEGTLDGLDH
SDFQDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAA
STGVQALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQW
CGGLPSTSFSFQ
Download sequence
Identical sequences ENSPANP00000018202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]