SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018221 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018221
Domain Number 1 Region: 28-154
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000724
Further Details:      
 
Domain Number 2 Region: 468-554
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-16
Family SH3-domain 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018221
Domain Number - Region: 627-685
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00113
Family Pointed domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018221   Gene: ENSPANG00000023646   Transcript: ENSPANT00000003341
Sequence length 711
Comment pep:known_by_projection chromosome:PapAnu2.0:19:47970614:47980340:1 gene:ENSPANG00000023646 transcript:ENSPANT00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAV
MDSQGRVWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLLLLVC
QEPERAQPDVHFFQGLRLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRDRSPA
AETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPGPAGTSSSADPASPDLGP
RGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRTRRRAAGEGLL
TLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPE
LASGVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELPPEEGPPYRPEFFSGW
EPPVTDPQGRAWEDPVEKQLQHERRRRQQSAPQVAVNGHQDLEPESEPQLESETAGKWVL
CNYDFQARNSSELSVKQRDVLEVLDDRRKWWKVRDPAGQEGYVPYNILTPHPGPRLHHCQ
SSARSLNSTPPPPPAPAPAPPPALARPRWDSCDSLNSLDPSEKEKFSQMLIVNEELQARL
AQGRSGPSRAVPGPRAPEPQLSPQSDASEVRAWLEAKGFSSGTVDALGVLTGAQLFSLQK
EELRAVSPEEGARVYSQVTVQRALLEKVSDLEAVMEKQKKKVEGGMETEVI
Download sequence
Identical sequences ENSPANP00000018221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]