SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018231 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018231
Domain Number 1 Region: 849-1066
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-59
Family DBL homology domain (DH-domain) 0.0000000636
Further Details:      
 
Domain Number 2 Region: 1052-1205
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-46
Family Pleckstrin-homology domain (PH domain) 0.00000206
Further Details:      
 
Domain Number 3 Region: 750-876
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-23
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018231   Gene: ENSPANG00000012759   Transcript: ENSPANT00000005095
Sequence length 1273
Comment pep:known_by_projection chromosome:PapAnu2.0:17:4011997:4164741:1 gene:ENSPANG00000012759 transcript:ENSPANT00000005095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQAAVRPWSPCPENMTTAPNGLGPGPAAPCPGSDLKDPKMVTSLACGNGVCGCSPGGDT
DTQEARLSPAKLVRLFATSRKRTSAHPERPRSVVLVGSSSTWNTLASFRKMGSFKKLKSS
VLKGIQSREGSNACSKGEALEHGLGKPILNGAVPGAQAGRGSPSAPGPACGTLRPAEGGT
LDGSDLEDTDDPFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTAATGQVPTMCEILVR
DPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAHDAQVPQRTLSSSSTDSQKP
GSGRTKRWRSPIRAKDFDRVFKLVSNVTEAAWRRESPRSGARSPGEAGLRLQAHSRLHDD
YSRRVSRSTEQDSRRGGAVMHGTTAACTVAAGFGSATSKDPHVDADAAVFPLEAKSSWAV
ESDSACAGSSSPSPIVQDVLSKDSCDQNAGSQFTFDPEQPPTPLRPTTPKPQSPQSPGAG
SAKCHSNHNAPSVSSEESEGRAEGSAQREPGPVSSQDPVEATRGVEGSKDLLVNTGGAAS
PEEEEEEVFHDGPWRRGSSQDEERTEAQRTPRRRWGSGRRPRPRPFSDYGQLASRSLSIP
EDSVAADPQKEDRVNEDPQASLTSASPEDQNAPVGCPRGARRRRPISVIGGVSLYGTNQT
EELDSLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSRSTPIGLDRVGRRRQMRASNISS
DGGTEPSALVDDNGSEEDLSYEDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDHV
TMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRLRVNQEELSENSISTRS
EEQDEEASQSRHRHCENKQQMRTNVIREIMDTERVYIKHLRDICEGYLRQCRKHTGMFTV
AQLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHP
GACLELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQ
EHGDYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHS
GELTKITKQGKSQQRMFFLFDHQLVSCKKDLLRRDMLYYKGRLDMDEMELVDLGDGRDKD
CNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADERRRVQEDQEMGMEISENQKK
LAMLNAQKTGHGKSKGYNRCPVAPPHQSLHPIHQRHITMPTSVPQQQVFGLAEPKRKPSL
FWHTFNRLTPFRK
Download sequence
Identical sequences A0A096NYR6
ENSPANP00000018231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]